PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G30110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CO-like
Protein Properties Length: 452aa    MW: 49315 Da    PI: 6.2655
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G30110.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box25.52.7e-081758338
         zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                     +r C+ + + +++++C  ++ +lC+ C ++ H+       H+
  OMERI02G30110.1 17 ARACDSCLRRRARWYCAADDAFLCQGCDTSVHSAnplarrHE 58
                     578*****************************6567777776 PP

2CCT69.67.8e-24400443144
              CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                      Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  OMERI02G30110.1 400 REARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRP 443
                      9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.7221562IPR000315B-box-type zinc finger
SMARTSM003361.6E-111562IPR000315B-box-type zinc finger
PfamPF006433.3E-71859IPR000315B-box-type zinc finger
CDDcd000211.35E-82062No hitNo description
PfamPF062033.1E-18400442IPR010402CCT domain
PROSITE profilePS5101716.122400442IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MSCSSEKAAG AVGGKAARAC DSCLRRRARW YCAADDAFLC QGCDTSVHSA NPLARRHERL  60
RLRASSPPPL TARASVEEEE EAAAVVGTTT KTSKRQGGVT PAWSKRKART RRPQVKSVGQ  120
LLSRRLVVPE MAVESSDERK ADEDGAHEEL EGQLLYRVPV FDPSLAEFCS PPPIDDAAAA  180
SSSCFKEDAA DGAVEDAKSP AAAPSSPVQQ LPDSFVNFEP TDAELREFAA DMEALLGQGL  240
DDSNELQDSF YMETLGLITP PVEESGRVKM EPDGGVASNS RVSLPSCRAH PKPEDVESAD  300
VLDIDFNCTS PDEQKSSASN GAAADSQFFH RSLDLRLNYE AIIESWGNSP WTDGRPPHGQ  360
LDDFWPNDHH YSGLWAAGGG GHEVGVGMMT VRPRMDGPGR EARVTRYREK RRTRLFSKKI  420
RYEVRKLNAE KRPRMKGRFV KRPSAAAPCA VT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1410426RRTRLFSKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1203140.0AK120314.1 Oryza sativa Japonica Group cDNA clone:J013055L13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622659.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A0E0CR210.0A0A0E0CR21_9ORYZ; Uncharacterized protein
STRINGLOC_Os02g49880.10.0(Oryza sativa Japonica Group)
STRINGORGLA02G0268200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32833058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.12e-44B-box type zinc finger protein with CCT domain